Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKMTRILCHWYLEYLENALIYMNKANNPFGKKALKKPDLVDQASIFITGAMNENKFST 4B60 Chain:A ((160-210)) ----------YYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTL-------

General information: TITO was launched using: RESULT: Template: 4B60.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 73 -2837 -38.86 -69.18 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -38.86 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.051

(partial model without unconserved sides chains): PDB file : Tito_4B60.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4B60-query.scw PDB file : Tito_Scwrl_4B60.pdb: