Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFKSPGFTIVELTITLVILVIMSVIAIPLYHQFMASVELKNTLRILTIHIQKAKYDAIIRHKNVVLCPSSD----QLVCNTNWDNRIISFVDNNRNLQHDLNEELLASID-LNHHYGSMKLQRFGKKQNSIIFQGNSGLPIESNGSFIYCSYDQLKKREFGLSRI 1EJ6 Chain:A ((959-1039)) -------------------------------------------------------------------PYSDMDALEKICRTAWPNCSITWVP----LSYDLRWTRLALLESTTLSSASIRIAELMYKYMPIMRIDIHGLPMEKRGNFI-----------------

General information: TITO was launched using: RESULT: Template: 1EJ6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 147 -2684 -18.26 -37.28 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -18.26 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.217

(partial model without unconserved sides chains): PDB file : Tito_1EJ6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1EJ6-query.scw PDB file : Tito_Scwrl_1EJ6.pdb: