Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKTFAPFFQVLGISITLCTQAVFADEGISTQEADSLIKDDIASTQVLQEICPTFVGANKKLETNTQKIIAMYLSGYSNKSITFSALQNDSEYKT-LLSEARQAAKEMDHHEQHELCEEVVNYKD 4GZA Chain:G ((25-81)) ----------------------------------------------------------------------------SNNVITFNGLANSSSYHTFLLDEER--SRLYVGAKDHIFSFNLVNIKD

General information: TITO was launched using: RESULT: Template: 4GZA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 116 1853 15.97 41.17 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain G : 0.59 3D Compatibility (PKB) : 15.97 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.59 QMean score : -0.072

(partial model without unconserved sides chains): PDB file : Tito_4GZA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GZA-query.scw PDB file : Tito_Scwrl_4GZA.pdb: