Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence RPYHGRIQDLRRPLLCDVYIEYPSGQVFDQALGHDIVPAGETAEISGFKCK--TVRGTCVILPTCDTPPEYRVTSWKFEREMSDPERTRFIARFPNVRI 2M3J Chain:A ((18-33)) ----------------------------------------------PLTCIPGDPYGICYII-------------------------------------

General information: TITO was launched using: RESULT: Template: 2M3J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 21 -8060 -383.81 -575.71 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -383.81 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 1.076

(partial model without unconserved sides chains): PDB file : Tito_2M3J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2M3J-query.scw PDB file : Tito_Scwrl_2M3J.pdb: