Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV 5A9X Chain:A ((382-443)) ------------------VSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQ----ALGERKGDL---------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5A9X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 45 -2764 -61.42 -61.42 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -61.42 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.404

(partial model without unconserved sides chains): PDB file : Tito_5A9X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5A9X-query.scw PDB file : Tito_Scwrl_5A9X.pdb: