Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHY 5I6V Chain:A ((112-217)) WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGD--------KSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHY

General information: TITO was launched using: RESULT: Template: 5I6V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 304 -41925 -137.91 -537.50 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.98 3D Compatibility (PKB) : -137.91 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.98 QMean score : 0.868

(partial model without unconserved sides chains): PDB file : Tito_5I6V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5I6V-query.scw PDB file : Tito_Scwrl_5I6V.pdb: