Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence EFHGIISREQADELLGGVE-GAYILRESQRQPGCYTLALRDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHL 2RSY Chain:A ((83-126)) -FHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKV--------------------------------

General information: TITO was launched using: RESULT: Template: 2RSY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 111 -7962 -71.73 -185.15 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -71.73 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.584

(partial model without unconserved sides chains): PDB file : Tito_2RSY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2RSY-query.scw PDB file : Tito_Scwrl_2RSY.pdb: