Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLC 4XZ0 Chain:A ((166-235)) WYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTL-

General information: TITO was launched using: RESULT: Template: 4XZ0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 222 -30518 -137.47 -435.96 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.90 3D Compatibility (PKB) : -137.47 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.90 QMean score : 0.567

(partial model without unconserved sides chains): PDB file : Tito_4XZ0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4XZ0-query.scw PDB file : Tito_Scwrl_4XZ0.pdb: