Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHF 4OHE Chain:A ((112-224)) WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRT--------KS-KVTHVMIRCQELKYDVGGGERFDSLTDLVEHY

General information: TITO was launched using: RESULT: Template: 4OHE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 292 -44889 -153.73 -590.64 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -153.73 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.761

(partial model without unconserved sides chains): PDB file : Tito_4OHE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OHE-query.scw PDB file : Tito_Scwrl_4OHE.pdb: