Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKF 2YSX Chain:A ((12-90)) WNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEGVSMRFFTKLDQLI---

General information: TITO was launched using: RESULT: Template: 2YSX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 275 -48678 -177.01 -616.18 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -177.01 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.574

(partial model without unconserved sides chains): PDB file : Tito_2YSX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2YSX-query.scw PDB file : Tito_Scwrl_2YSX.pdb: