Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDHH 1WQU Chain:A ((18-87)) WYHGAIPRAEVAELLVHSGDFLVRES-QGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDH-

General information: TITO was launched using: RESULT: Template: 1WQU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 235 -39377 -167.56 -562.53 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -167.56 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.592

(partial model without unconserved sides chains): PDB file : Tito_1WQU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WQU-query.scw PDB file : Tito_Scwrl_1WQU.pdb: