Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------------------------------MIYKVFYQETKERSPRRETTRTLYLDIDASSELE-GRITARQLVEENRPEYNIEYIELLSDKLLDYEKETGAFEITEF---------------------------------------------------------------------------- 5FQ3 Chain:A ((15-213)) FVTLEREGDEKIVLEKGQPFVEPGYYAEMNGEDITESVQIKGSVDVNTPGIYNLVYAAYNEDGFAKTFTRTVYVADNTASPLKSGIYTVAEGSKRTAPSV----VAFSGYEIVIFQMEPGIFYISDFLGGWYDQRAGYGPDYAMVGKFELNDDNTITPLESYVAGWGDSMDQMTNTLLDPATGTLKWTVAYAGQLSFDIIVKQ

General information: TITO was launched using: RESULT: Template: 5FQ3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 267 2587 9.69 35.43 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 9.69 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.175

(partial model without unconserved sides chains): PDB file : Tito_5FQ3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FQ3-query.scw PDB file : Tito_Scwrl_5FQ3.pdb: