Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEIAAEFNCPPTTIHYALKAMGYSLKKS--RTYCEQDPEKVNRFLKELNHLSYLTPIYIYETGVETYFYLEYDRALSRQLVSLEEDIII 1JKS Chain:A ((35-107)) ------------TGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVITLHEVYENKTDVILILE------------------

General information: TITO was launched using: RESULT: Template: 1JKS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 152 1143 7.52 19.71 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 7.52 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.279

(partial model without unconserved sides chains): PDB file : Tito_1JKS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JKS-query.scw PDB file : Tito_Scwrl_1JKS.pdb: