Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSRVRVQIMNQFHRKSHEYKAIKRYWKLIQQDSRKLSDKRFYRPTFRMHLTNKEILDKILSYSEDLKHHYQIYQLLLFHFQNKDPEKFFGLIEDNLKQVHPIFQTVFKTFLKNKEKIVNALQLPYSNAKIGSDQ 5U0S Chain:R ((89-157)) ----------------------------------KREDKCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEY-IIQGLEYFFFDTTVRIYQTLIPSQQRSIKPPFH------------------------------

General information: TITO was launched using: RESULT: Template: 5U0S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 95 -8646 -91.01 -125.30 target 2D structure prediction score : 0.22 Monomeric hydrophicity matching model chain R : 0.64 3D Compatibility (PKB) : -91.01 2D Compatibility (Sec. Struct. Predict.) : 0.22 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.025

(partial model without unconserved sides chains): PDB file : Tito_5U0S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5U0S-query.scw PDB file : Tito_Scwrl_5U0S.pdb: