Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFTCFIIHRTTIPYFVSQEVYWKVRNIEAEAIRRNCERGAIFSGKIKYHEDSQFKGDHYVECYAVLDNTVIARDRITVPIDPLCGKDFIE 1M8U Chain:A ((1-19)) -------------------------------------------GKITFYEDRGFQGRHY-EC----------------------------

General information: TITO was launched using: RESULT: Template: 1M8U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 28 -2954 -105.50 -164.11 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -105.50 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.695

(partial model without unconserved sides chains): PDB file : Tito_1M8U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1M8U-query.scw PDB file : Tito_Scwrl_1M8U.pdb: