Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRSGRDKKIAGVCAGVAHYLDMDPTIVRVIWGVLTCCYGAGIVAYIILWIIAPVATDY 1I1Q Chain:B ((74-92)) ---RGKLPIIGICLGH------------------------------------------

General information: TITO was launched using: RESULT: Template: 1I1Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 5 -393 -78.50 -30.19 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain B : 0.39 3D Compatibility (PKB) : -78.50 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.39 QMean score : 0.522

(partial model without unconserved sides chains): PDB file : Tito_1I1Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1I1Q-query.scw PDB file : Tito_Scwrl_1I1Q.pdb: