Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNDEASKQLTDTRFKRLVGVQRTTFEEMLAVLKTAYQKSRTSW 1UJS Chain:A ((48-67)) --------LSQEEFYQVFGMTISEFDRL---------------

General information: TITO was launched using: RESULT: Template: 1UJS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 32 -6546 -204.56 -327.30 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -204.56 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.865

(partial model without unconserved sides chains): PDB file : Tito_1UJS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UJS-query.scw PDB file : Tito_Scwrl_1UJS.pdb: