Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MCNVQLKNRLKELRARDGLNQTDLAKLAGVSRQTISLLERDEYTPSIIIALKISQIFNETVESVFRLEEDE 2LYQ Chain:A ((4-66)) -------NNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE-

General information: TITO was launched using: RESULT: Template: 2LYQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 229 -23151 -101.09 -367.47 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.82 3D Compatibility (PKB) : -101.09 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.660

(partial model without unconserved sides chains): PDB file : Tito_2LYQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LYQ-query.scw PDB file : Tito_Scwrl_2LYQ.pdb: