Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKR-YQKKLARESVRTTRLY 3JD5 Chain:U ((12-70)) ---VMVQEGN-VEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYNMEMAR---------

General information: TITO was launched using: RESULT: Template: 3JD5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain U - contact count / total energy / energy per contact / energy per residue : 45 -661 -14.69 -11.40 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain U : 0.78 3D Compatibility (PKB) : -14.69 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.733

(partial model without unconserved sides chains): PDB file : Tito_3JD5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3JD5-query.scw PDB file : Tito_Scwrl_3JD5.pdb: