Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNEIEMFCELLSLLGLKVVPKDYQSIDKERVAALLVMSKSWMNRIETVDDLFHDEISCQKEKLGY 1TUE Chain:B ((55-88)) ----------IQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQ---------------------

General information: TITO was launched using: RESULT: Template: 1TUE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 15 -2387 -159.13 -70.21 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : -159.13 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.397

(partial model without unconserved sides chains): PDB file : Tito_1TUE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TUE-query.scw PDB file : Tito_Scwrl_1TUE.pdb: