Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MANKEELIEFEGVVTETLPNTMFRVRLENGHEVVAHISGKMRKHYIRILTGDSVKVEMTPYDLTKGRITYRAR 5LMO Chain:W ((1-70)) -AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYR--

General information: TITO was launched using: RESULT: Template: 5LMO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 280 -29540 -105.50 -422.00 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain W : 0.88 3D Compatibility (PKB) : -105.50 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.470

(partial model without unconserved sides chains): PDB file : Tito_5LMO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5LMO-query.scw PDB file : Tito_Scwrl_5LMO.pdb: