Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVALSFDWVFFFGVNMDTIEAKKNLNALCNEIEKLQNLSRSLMTAKEMLDIDAKIKRHKEQVKNIRSNLHA 2V8S Chain:V ((47-94)) --------------------DFDEKQQEANETLAEMEEELRY-APLTFRNPMMSKLRNYRKDLAKLHRE---

General information: TITO was launched using: RESULT: Template: 2V8S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain V - contact count / total energy / energy per contact / energy per residue : 53 -8177 -154.27 -170.34 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain V : 0.56 3D Compatibility (PKB) : -154.27 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.840

(partial model without unconserved sides chains): PDB file : Tito_2V8S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2V8S-query.scw PDB file : Tito_Scwrl_2V8S.pdb: