Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MARNADYIDIAGFTIAPQTLLPYGHLYNASLAGNQLNSAHGFAGPILAAPI-WLINKPERFFAIAPYLYVPIGTYHSDEALNIDENRWKFDLQLGVFNNVAMIFLPKSRPMLFDMVHMMILLE 4RL8 Chain:D ((63-142)) ------------LTLEPQFLLPFGRVSSSGDA-SALGDTSGVGDLTLTAPLKYRLNEANDILGATVYLTAPTGNYNRDDALNLGENRWKVDLQ------------------------------

General information: TITO was launched using: RESULT: Template: 4RL8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 265 -12350 -46.60 -156.33 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain D : 0.68 3D Compatibility (PKB) : -46.60 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.277

(partial model without unconserved sides chains): PDB file : Tito_4RL8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4RL8-query.scw PDB file : Tito_Scwrl_4RL8.pdb: