Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKKNNAPELHKYRGLTSTEQMVIHQMLISYVREENCRFNIIMTGTAEPYNLVKLTSINFENEASAIWVHFETITGEQIALPIDFLSRIEFSGQQEI 1ZRI Chain:A ((41-62)) --------------------------------------------------------------------------DGEKLLRPAESVYRLDFIQQQK-

General information: TITO was launched using: RESULT: Template: 1ZRI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -240 -119.75 -10.89 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -119.75 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.357

(partial model without unconserved sides chains): PDB file : Tito_1ZRI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ZRI-query.scw PDB file : Tito_Scwrl_1ZRI.pdb: