Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLWFASRHPQMPWLPKIIAVVAVAYAFSPIDLIPD--FIPILGFIDDAVILPILIWLAVRFTPQQVIFDAEQQAKEWLDEHEKRPKNYLVAVLIILIWLTLAVMAYFYFGGGL 1TX9 Chain:B ((78-109)) ------------------IAAVIAYYVHPVNIQTACLIMEGAEFTENIIN---------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1TX9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 37 -10268 -277.50 -342.25 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain B : 0.46 3D Compatibility (PKB) : -277.50 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.063

(partial model without unconserved sides chains): PDB file : Tito_1TX9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TX9-query.scw PDB file : Tito_Scwrl_1TX9.pdb: