Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKSEKLDHSLLGKQRKTVETVFSSLE-KLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY 4KBB Chain:D ((40-55)) -----------------SQEDMFAKLKEKFFNE------------------------------------------

General information: TITO was launched using: RESULT: Template: 4KBB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 2 -73 -36.25 -4.83 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain D : 0.59 3D Compatibility (PKB) : -36.25 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.640

(partial model without unconserved sides chains): PDB file : Tito_4KBB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KBB-query.scw PDB file : Tito_Scwrl_4KBB.pdb: