Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPNNRILLVFSITIKGAVFLIKELFNLNKRKDSIAKAIKLFLTRKTLIKQRNVLNLMTACLMGVLAII 1Q90 Chain:R ((9-24)) -----------------------------------------------MNKRNIMNLILAGGAG-----

General information: TITO was launched using: RESULT: Template: 1Q90.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 1 -233 -232.50 -14.53 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain R : 0.53 3D Compatibility (PKB) : -232.50 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.541

(partial model without unconserved sides chains): PDB file : Tito_1Q90.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Q90-query.scw PDB file : Tito_Scwrl_1Q90.pdb: