Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLSMNLQLFAHKKGGGSTSNGRDSESKRLGAKRADGQTVTGGSILYRQRGTKIYPGVNVGIGGDDTLFAKVDGVVRFERKGRNKKQVSVYPVAQEA 5MMI Chain:X ((66-139)) ------------------TKNGRDSKGQRLGVKIYGDQVAKPGAIIIRQRGTKFHPGKNVGIGKDHTIFALIDGLVKFEKYGPDKKKVSVYP-----

General information: TITO was launched using: RESULT: Template: 5MMI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 295 -30942 -104.89 -418.13 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain X : 0.77 3D Compatibility (PKB) : -104.89 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.699

(partial model without unconserved sides chains): PDB file : Tito_5MMI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5MMI-query.scw PDB file : Tito_Scwrl_5MMI.pdb: