Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYY 2CI9 Chain:B ((7-81)) WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQ-GKNKHFKVQLKETVYCIGQRKFSTMEELVEHY

General information: TITO was launched using: RESULT: Template: 2CI9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 277 -34550 -124.73 -460.66 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain B : 0.74 3D Compatibility (PKB) : -124.73 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.593

(partial model without unconserved sides chains): PDB file : Tito_2CI9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CI9-query.scw PDB file : Tito_Scwrl_2CI9.pdb: