Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1P13 Chain:B ((4-86)) WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYY

General information: TITO was launched using: RESULT: Template: 1P13.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 255 -9101 -35.69 -116.67 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain B : 0.86 3D Compatibility (PKB) : -35.69 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.639

(partial model without unconserved sides chains): PDB file : Tito_1P13.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1P13-query.scw PDB file : Tito_Scwrl_1P13.pdb: