Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MCRILGLSRQSYYYQSKPKKDESELEEVVAEEFIRSRKAYGSRKIKKALSKRGIQISRRKISRIMKNRGLKSSYTVAYFKVHHSTCNEAKTTNVLNS 3RPF Chain:C ((3-74)) -VEVRFFGPIKEENFFIKANDLKELRAILQEK----------EGLKEWLGVCAIALNDHLIDNL--NTPLKDGDVISLL------------PPVCGG

General information: TITO was launched using: RESULT: Template: 3RPF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 244 -30852 -126.44 -428.50 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -126.44 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.404

(partial model without unconserved sides chains): PDB file : Tito_3RPF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3RPF-query.scw PDB file : Tito_Scwrl_3RPF.pdb: