Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEFTGMSNQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDARDQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIALG 3R2D Chain:K ((5-82)) --------EKIRIKLRAYDHRLLDQSVKQIIETVKRTGGVVKGPIPLPTRKSEFS---------------------RILDIIRFTPQTIEALMEISLPAGVDVEVKM-

General information: TITO was launched using: RESULT: Template: 3R2D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 317 -42846 -135.16 -549.30 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain K : 0.81 3D Compatibility (PKB) : -135.16 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.603

(partial model without unconserved sides chains): PDB file : Tito_3R2D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3R2D-query.scw PDB file : Tito_Scwrl_3R2D.pdb: