Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKGIGIDAVELPRITRLIEEKPKFIARILTSDEMKLFQSLP-FHRQVEFLGGRYACKEAFSKAWGTGIGK-VPFKMSRF 5CXD Chain:B ((4-81)) MIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDI--

General information: TITO was launched using: RESULT: Template: 5CXD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 206 -17340 -84.17 -228.15 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain B : 0.88 3D Compatibility (PKB) : -84.17 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.477

(partial model without unconserved sides chains): PDB file : Tito_5CXD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5CXD-query.scw PDB file : Tito_Scwrl_5CXD.pdb: