Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKGIGIDAVELPRITRLIEEKPKFIARILTSDEMKLFQSLPFHRQVEFLGGRYACKEAFSKAWGTGIGK-VPFKMSRF 1F80 Chain:B ((2-76)) --YGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEARKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDI--

General information: TITO was launched using: RESULT: Template: 1F80.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 223 -20662 -92.65 -279.22 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain B : 0.80 3D Compatibility (PKB) : -92.65 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.562

(partial model without unconserved sides chains): PDB file : Tito_1F80.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F80-query.scw PDB file : Tito_Scwrl_1F80.pdb: