Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQLTLVRHGEAAPPVN---GNDIKRPLTARGHAQAEQTATFLKDIVKPNIFVVSPLLRAQETLAHIQTYFKDVPVLLCDKI-----------------------------------KPDDDAKE--------AIEWLSQI-PYESIVVVCHMNVVGHIAELLTHET-----FNPFALAEARIYDQAVIANGLSTQKNSFIPTI
4IJ5 Chain:A ((2-194))VKLILVRHAESEWNPVGRYQGLLDPDLSERGKKQAKLLAQELSREH-LDVIYSSPLKRTYLTALEIAEAKN-LEVIKEDRIIEIDHGMWSGMLVEEVMEKYPEDFRRWVEEPHKVEFQGGESLASVYNRVKGFLEEVRKRHWNQTVVVVSHTVPMRAMYCALLGVDLSKFWSFGCDNASYSVIHMEER---RNVILKL-----


General information:
TITO was launched using:
RESULT:

Template: 4IJ5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 562 18321 32.60 129.93
target 2D structure prediction score : 0.65
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : 32.60
2D Compatibility (Sec. Struct. Predict.) : 0.65
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.469

(partial model without unconserved sides chains):
PDB file : Tito_4IJ5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4IJ5-query.scw
PDB file : Tito_Scwrl_4IJ5.pdb: