Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIRRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1BKM Chain:A ((6-88)) WYFGKITRRESEALLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYY

General information: TITO was launched using: RESULT: Template: 1BKM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 251 -4605 -18.34 -59.03 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -18.34 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.616

(partial model without unconserved sides chains): PDB file : Tito_1BKM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BKM-query.scw PDB file : Tito_Scwrl_1BKM.pdb: