Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIRRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1SHD Chain:A ((9-91)) WYFGKITRRESERLLLNAENPRGTFLVRESE----AYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY

General information: TITO was launched using: RESULT: Template: 1SHD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 249 -10741 -43.13 -145.14 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -43.13 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.678

(partial model without unconserved sides chains): PDB file : Tito_1SHD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1SHD-query.scw PDB file : Tito_Scwrl_1SHD.pdb: