Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence TGNKYIEKRAIDLSRERDPNFFDNPGIPVPECFWFMFKNNVRQDDGTCYSSWKMDMKVGPNWVHIKSDDNCNLSGDFPPGWIVLGKKRPGF 2GPF Chain:A ((30-40)) ---------------------------------------------------------------------------EIPQGWRAAGK-----

General information: TITO was launched using: RESULT: Template: 2GPF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -919 -459.25 -83.50 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -459.25 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.764

(partial model without unconserved sides chains): PDB file : Tito_2GPF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GPF-query.scw PDB file : Tito_Scwrl_2GPF.pdb: