Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKCKKYEEFGLDSLLQETRGGRNHAYMTVEQEKVFLARHLKATEAGEFVTIDALFQAYKKEL----GRSYTRDAFYQLLKRHGWRNITPRPEHPRKADAQTIVASKNKVSIQEDK 1K78 Chain:A ((66-142)) SKILGRYYETGSIKPG-VIGGSKP-KVATPKVVEKI-AEYKRQ---NPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTK---------------------------------

General information: TITO was launched using: RESULT: Template: 1K78.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 170 -10675 -62.79 -146.23 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -62.79 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.661

(partial model without unconserved sides chains): PDB file : Tito_1K78.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1K78-query.scw PDB file : Tito_Scwrl_1K78.pdb: