Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMDKTFLHRQLLKNLINVLYTYFQEKKRENLKKISVTQNTDFIDLLVIATKDT 1OG2 Chain:A ((211-250)) -------HNKLLKN-VAFMKSYILEKVKEHQESMDMNNPQDFIDCFLM-----

General information: TITO was launched using: RESULT: Template: 1OG2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 45 -4773 -106.07 -119.33 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -106.07 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.370

(partial model without unconserved sides chains): PDB file : Tito_1OG2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OG2-query.scw PDB file : Tito_Scwrl_1OG2.pdb: