Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQELLAQLQAGTAKFSDVLAYIEARYQ--HTPT--AFQNGA-QHNAATENQGSAKVFSFAKLQGLDQAQTLILFAEHYASVLAPPEGTDHQNIRQFMQNGWDGVKFEGQALTEK 1UVI Chain:C ((563-628)) --------------IYSDVLEAIERCWWNAFGESYRAYREDMLKRDTLELSRYVASMARQAGLAELTPID---------LEVLADPNKL--------------------------

General information: TITO was launched using: RESULT: Template: 1UVI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 91 10054 110.48 164.81 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain C : 0.63 3D Compatibility (PKB) : 110.48 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.388

(partial model without unconserved sides chains): PDB file : Tito_1UVI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UVI-query.scw PDB file : Tito_Scwrl_1UVI.pdb: