Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKIDNDSPSPSPEQYKPIGLIICYLLLGLPASLTIGSLIAQVLTINVSDFEGGRGYAWVWILMIISSLTYLACLIALPIVIKKYVNALSTVVIVFGILSIFSLSFLASL 3DL8 Chain:E ((52-72)) ----------------------------------------------------------TKATYWLGALFLVLA-LLLSVI-----------------------------

General information: TITO was launched using: RESULT: Template: 3DL8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 5 -1275 -254.90 -60.69 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain E : 0.44 3D Compatibility (PKB) : -254.90 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.44 QMean score : 0.069

(partial model without unconserved sides chains): PDB file : Tito_3DL8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DL8-query.scw PDB file : Tito_Scwrl_3DL8.pdb: