Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLFISTAHAAPAAAQSPGLLPNILMIVVFVAIFYFLIWRPQAKRAKEHRSLIESLGVG---SEVVFAGGLMGKVTKLEGDYAVVELNRGVEVKIQRASVISVLPEGTLNNL 5EUL Chain:Y ((142-231)) ---------------QNP-IGTYLLIAVVLTAGTAFLMWLGEQITAK---------GVGNGISIIIFAGIVSGIPTILNQIYA-----------------------------

General information: TITO was launched using: RESULT: Template: 5EUL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Y - contact count / total energy / energy per contact / energy per residue : 60 -5131 -85.52 -93.29 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain Y : 0.61 3D Compatibility (PKB) : -85.52 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.278

(partial model without unconserved sides chains): PDB file : Tito_5EUL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EUL-query.scw PDB file : Tito_Scwrl_5EUL.pdb: