Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKTFAPFFQVLGISITLCTQAVFADEGISTQEADSLIKDDIASTQVLQEICPTFVGANKKLETNTQKIIAMYLSGYSNKSITFSALQNDSEYKT-LLSEARQAAKEMDHHEQHELCEEVVNYKD 1Q47 Chain:A ((17-73)) ----------------------------------------------------------------------------SNNVITFNGLANSSSYHTFLLDEER--SRLYVGAKDHIFSFNLVNIKD

General information: TITO was launched using: RESULT: Template: 1Q47.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 116 1853 15.97 41.17 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 15.97 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.59 QMean score : -0.003

(partial model without unconserved sides chains): PDB file : Tito_1Q47.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Q47-query.scw PDB file : Tito_Scwrl_1Q47.pdb: