Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEVFAMNSEQLTQILKEAFPEAEVVVSGQAGKFD---LRIVDDQFEGKRTVARQQAVYAPLNTYIASGEVHAVTIRAMTKDEWRKASLFGA 2MCQ Chain:A ((1-75)) ----MAISAEELEKILKKSFPSSVIKITDLVGDQDHYALEISDAQFNGLSLINQHKLVKNAL-SEILNKKLHSISIKTIS------------

General information: TITO was launched using: RESULT: Template: 2MCQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 213 -11597 -54.44 -161.06 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -54.44 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.506

(partial model without unconserved sides chains): PDB file : Tito_2MCQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MCQ-query.scw PDB file : Tito_Scwrl_2MCQ.pdb: