Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQTTNLTEVQDILQQSSVAVIYLSMPNCSVCHAVRPRLEELLTHY-DIPALHLDAFETPEVASKFEVLTAPVVLIFHQGKEVFRQARFIDFKKIRYLLDELTAEDDSLSYEEIFRTK 2OE0 Chain:A ((8-88)) ----TNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGK---------------------------------

General information: TITO was launched using: RESULT: Template: 2OE0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 281 -37813 -134.56 -472.66 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -134.56 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.744

(partial model without unconserved sides chains): PDB file : Tito_2OE0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OE0-query.scw PDB file : Tito_Scwrl_2OE0.pdb: