Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MICSANSERQINAITEEIIDKEEENKYEVKRIEGKEGGKWVLIDLGDVIVHVFHAPERNFYNLEKLWSDAPL--VDLSEWLD 4WCW Chain:C ((42-118)) VIASGSNERQVNAIVDEVEEKMRQAGYRPARREGAREGRWTLLDYRDIVVHIQHQDDRNFAALDRLWGDCPVVPVDL-----

General information: TITO was launched using: RESULT: Template: 4WCW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 221 -33851 -153.17 -451.34 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain C : 0.81 3D Compatibility (PKB) : -153.17 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.578

(partial model without unconserved sides chains): PDB file : Tito_4WCW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WCW-query.scw PDB file : Tito_Scwrl_4WCW.pdb: