Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ICDIVIRFEGAVVETGTMGPSTAKTFNLITDQISITVDHNC--NITHWTQVEKFTVSSTLRNPPAAAAARR 5HJ3 Chain:P ((4-25)) ----------------------------------VNAQPKCNPNLHYWTTQDEGAA---------------

General information: TITO was launched using: RESULT: Template: 5HJ3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 1 -74 -73.50 -3.68 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain P : 0.56 3D Compatibility (PKB) : -73.50 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.439

(partial model without unconserved sides chains): PDB file : Tito_5HJ3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5HJ3-query.scw PDB file : Tito_Scwrl_5HJ3.pdb: