Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CTYSVYDSIGKMVVEDKDLPTNRRDYYTIGKKKYTFYFKENCDFDYSKPPLPRCWHVSGIPKGLYDQVQGMEQPCPAQ 4BJJ Chain:A ((91-110)) ---------------------------NVSRIRQVFLFRDMADFQYS-------------------------------

General information: TITO was launched using: RESULT: Template: 4BJJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 6 113 18.75 5.63 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 18.75 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.410

(partial model without unconserved sides chains): PDB file : Tito_4BJJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BJJ-query.scw PDB file : Tito_Scwrl_4BJJ.pdb: