Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LIIGFISKQYVTSLLLNEPDGTFLLRFSD-SEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGNRIRDLAQLKNLY 3CWG Chain:A ((585-654)) -IMGFISKERERAI-STKPPGTFLLRFSESSKEGGVTFTW-------KTQIQSVEPYTKQQLN---FAEII----------

General information: TITO was launched using: RESULT: Template: 3CWG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 184 -12183 -66.21 -210.05 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : -66.21 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.596

(partial model without unconserved sides chains): PDB file : Tito_3CWG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CWG-query.scw PDB file : Tito_Scwrl_3CWG.pdb: